PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00016.1.g06070.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 988aa    MW: 105039 Da    PI: 8.195
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00016.1.g06070.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1161.5e-3690148361
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   e  lkcprCds+ntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Zjn_sc00016.1.g06070.1.am.mk  90 EPGLKCPRCDSANTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 148
                                   56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3873145IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3193147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.67793147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
Gene3DG3DSA:1.25.40.902.9E-15440551IPR008942ENTH/VHS
SMARTSM002733.4E-4440559IPR013809ENTH domain
PfamPF076512.4E-47441715IPR011417AP180 N-terminal homology (ANTH) domain
SuperFamilySSF484644.91E-15441551IPR008942ENTH/VHS
SuperFamilySSF890095.1E-34586715No hitNo description
Gene3DG3DSA:1.20.58.1507.7E-31591716IPR014712Phosphoinositide-binding clathrin adaptor, domain 2
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048268Biological Processclathrin coat assembly
GO:0030136Cellular Componentclathrin-coated vesicle
GO:0003677Molecular FunctionDNA binding
GO:0005545Molecular Function1-phosphatidylinositol binding
GO:0030276Molecular Functionclathrin binding
Sequence ? help Back to Top
Protein Sequence    Length: 988 aa     Download sequence    Send to blast
MIFPPAFLDS SSWNDNQHHQ QQQQAHHQVA ANNGDGTNHE QLLHPSIMSG GALPEGGGGA  60
GAGAGAQMVG PAKPMSMSER ARLARIPLPE PGLKCPRCDS ANTKFCYFNN YSLSQPRHFC  120
RACRRYWTRG GALRNVPVGG GYRRHAKRAK PKAAAAATPA GTTAAATAAL VPSGSTSSTS  180
TTANVPALSG PAGMLGGNLS MLPPLLRLAD FDAMSLGSSF TGIGKPTLDA AGNYSIGGAS  240
GGGAGAGLEQ WRVHQQMQGF PFLHAMDQGS LPPSLAMVMP GAFQLGLDPT DGRGVGTGGG  300
EDGSTGDLNG MPTKREGGYP RGMYGDHHLA AGYTTSPRED PTRPMAGRQA SCSSLPQSSV  360
HHPTPRTGQK KRGKSAFACR RLRSCQPVHK KPPVSSSPPL FLAEHQQQRQ RAKMSIRKAL  420
GAVKDQTTIS LAKVTGAVSP DLDVAVVRAT SHDDAPADAR HTAQVLRLTS GEGGSRAHVA  480
ACGLALVHRL VAEGDPHFRH EVLRPALAGR RAGEPLLALL GDFRDEAHSA SWDHSAFVRS  540
YAAYLDARVR FLVSLLPPPR SVRFADDPMF ASASSFSSPP NSSTSVHDMD PESLLTRSRQ  600
LRDLLDRVLA CRPSGAARNS RVVLAALYQL LKDSFQLHAD VTVVLAVLLD RFFDMEYSHC  660
VKAFEAYVGA AKQIDGLLGF YDWCKDVGVA RAADFPDVSR IDDKLLETFE QFLRERGRAV  720
QNDQSFLPPP PQSQVAPATQ QQRVDQDDQY DDMNRVKALP APAETPAAAR KTADPHQSDG  780
TDHQLVDLRE PADDQGNKLA LALFNAPPPP ATNGEWVAFP SDSDNTSVTS AWQTPAAEPG  840
NSDWELALIE TASTLSRQKA ALGGGLDPLL LGGMYDQGTV RQQVAAQAAS GSASSVAFPG  900
RRVAPVLALP APDGTVRTVG GDPFAASLAM AEMERKQELL VQEQQMWAQY RQHGMQGQPA  960
GLAAGGMTMP MPYGIPAMAY NQSAGYYY
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1089333e-95AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
GenBankGQ1835523e-95GQ183552.1 Oryza sativa Japonica Group Dof-type zinc finger protein 25 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960513.10.0PREDICTED: probable clathrin assembly protein At4g32285
SwissprotQ8S9J81e-157CAP1_ARATH; Probable clathrin assembly protein At4g32285
TrEMBLK3Z4M90.0K3Z4M9_SETIT; Uncharacterized protein
STRINGSi021497m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.28e-42OBF-binding protein 3